Tested Applications
| Positive WB detected in | HEK-293T cells, mouse testis tissue, RAW 264.7 cells, HeLa cells, HepG2 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human pancreas cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 9 publications below |
| IHC | See 2 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
Product Information
27013-1-AP targets TRIM26 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25546 Product name: Recombinant human TRIM26 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-270 aa of BC024039 Sequence: NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFW Predict reactive species |
| Full Name | tripartite motif-containing 26 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | BC024039 |
| Gene Symbol | TRIM26 |
| Gene ID (NCBI) | 7726 |
| RRID | AB_2880721 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12899 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRIM26 is a member of the tripartite motif (TRIM) protein family composed of more than 70 members in human. TRIM proteins share a similar characteristic structure, which includes a RING (R) domain, one or two B-boxes (B), and a coiled coil (CC) domain in the N-terminal and a domain in the C-terminal with variable structures. TRIM26 potentiates virus-triggered IRF3, NF-κB activation, IFN-β induction, and cellular antiviral responses. Further investigation suggests that TRIM26 plays an important role in the antiviral innate immune response by bridging TBK1 to NEMO and mediating TBK1 activation. (PMID: 25763818, PMID: 26611359)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TRIM26 antibody 27013-1-AP | Download protocol |
| IP protocol for TRIM26 antibody 27013-1-AP | Download protocol |
| WB protocol for TRIM26 antibody 27013-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Dis The E3 ligase TRIM26 suppresses ferroptosis through catalyzing K63-linked ubiquitination of GPX4 in glioma | ||
Virus Res TRIM26-mediated degradation of nucleocapsid protein limits porcine reproductive and respiratory syndrome virus-2 infection. | ||
Asian J Androl Inhibition of the PI3K/AKT signaling pathway blocks the oncogenic activity of TRIM26 in prostate cancer cells
| ||
Medicine (Baltimore) Construction and multiple validations of a robust ferroptosis-related prognostic model in bladder cancer: A comprehensive study | ||
Cell Death Dis TRIM26 deficiency enhancing liver regeneration through macrophage polarization and β-catenin pathway activation
| ||
Aging (Albany NY) Machine learning-based identification and immune characterization of ferroptosis-related molecular clusters in osteoarthritis and validation |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Xingyuan (Verified Customer) (03-20-2024) | Protein quality was good.
![]() |






















