Product Information
84661-4-PBS targets TRIM26 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25546 Product name: Recombinant human TRIM26 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-270 aa of BC024039 Sequence: NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFW Predict reactive species |
| Full Name | tripartite motif-containing 26 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC024039 |
| Gene Symbol | TRIM26 |
| Gene ID (NCBI) | 7726 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q12899 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TRIM26 is a member of the tripartite motif (TRIM) protein family composed of more than 70 members in human. TRIM proteins share a similar characteristic structure, which includes a RING (R) domain, one or two B-boxes (B), and a coiled coil (CC) domain in the N-terminal and a domain in the C-terminal with variable structures. TRIM26 potentiates virus-triggered IRF3, NF-κB activation, IFN-β induction, and cellular antiviral responses. Further investigation suggests that TRIM26 plays an important role in the antiviral innate immune response by bridging TBK1 to NEMO and mediating TBK1 activation. (PMID: 25763818, PMID: 26611359)







