Tested Applications
| Positive IHC detected in | mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25913-1-AP targets TRIM36 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23240 Product name: Recombinant human TRIM36 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 166-215 aa of BC130334 Sequence: ESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEH Predict reactive species |
| Full Name | tripartite motif-containing 36 |
| Observed Molecular Weight | 83 kDa |
| GenBank Accession Number | BC130334 |
| Gene Symbol | TRIM36 |
| Gene ID (NCBI) | 55521 |
| RRID | AB_2880293 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NQ86 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRIM36, a member of the tripartite motif (TRIM) family of RING-containing proteins, also known as Haprin, is a microtubule-associated E3 ubiquitin ligase that plays a role in cytoskeletal organization, which was first discovered for its abundance in testis and found to be implicated in the spermatozoa acrosome reaction (PMID: 35053362, 30944633). TRIM36 was reported as a novel androgen signaling target gene and is upregulated in prostate cancer (PMID: 29449534).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRIM36 antibody 25913-1-AP | Download protocol |
| IHC protocol for TRIM36 antibody 25913-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











