Tested Applications
| Positive WB detected in | A431 cells, A594 cells, Jurkat cells, U-87 MG cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84354-1-RR targets TRIM43 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34926 Product name: Recombinant human TRIM43 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 140-240 aa of BC015353 Sequence: LLKQMRILWKKIQENQRNLYEEGRTAFLWRGNVVLRAQMIRNEYRKLHPVLHKEEKQHLERLNKEYQEIFQQLQRSWVKMDQKSKHLKEMYQELMEMCHKP Predict reactive species |
| Full Name | tripartite motif-containing 43 |
| Observed Molecular Weight | 52-60 kDa |
| GenBank Accession Number | BC015353 |
| Gene Symbol | TRIM43 |
| Gene ID (NCBI) | 129868 |
| RRID | AB_3671892 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q96BQ3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRIM43 (tripartite motif containing 43), also known as TRIM43A. It is expected to be located in the cytoplasm. The calculated molecular weight of TRIM43 is 52 kDa. TRIM43 was also upregulated in herpesvirus-associated diseases in humans, including γ herpesvirus-associated tumors. As such, TRIM43 and its transcription factor DUX4 could potentially serve as biomarkers of active herpesviral replication and pathogenesis (PMID: 30420784).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TRIM43 antibody 84354-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



