Tested Applications
Positive WB detected in | A549 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67492-1-Ig targets TRIM5 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30059 Product name: Recombinant human TRIM5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 136-224 aa of BC021258 Sequence: REYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQ Predict reactive species |
Full Name | tripartite motif-containing 5 |
Calculated Molecular Weight | 493 aa, 56 kDa |
Observed Molecular Weight | 56 kDa |
GenBank Accession Number | BC021258 |
Gene Symbol | TRIM5 |
Gene ID (NCBI) | 85363 |
RRID | AB_2882717 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9C035 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRIM5 belongs to the large tripartite motif protein family, members of which typically are composed of 3 zinc-binding domains, a RING, unique B-box type 1 and B-box type 2 domains, followed by a coiled-coil (CC) region. TRIM proteins use homomultimerization to identify specific cell compartments. TRIM5 promotes innate immune signaling and that this activity is amplified by retroviral infection and interaction with the capsid lattice. TRIM5 has 6 variants termed alpha, beta, gamma, delta, epsilon, and iota with the MW of 56 kDa, 46 kDa, 40 kDa, 37 kDa, 31 kDa and 29 kDa. TRIM5 can form homodimers (~70 kDa) and homotrimers (90-160 kDa).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TRIM5 antibody 67492-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |