TRIM56 Polyclonal antibody

• 

  WB analysis using 25509-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25509-1-AP (TRIM56 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

TRIM56 Polyclonal Antibody for WB, ELISA

Cat No. 25509-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

E3 ubiquitin-protein ligase TRIM56, EC:2.3.2.27, RING finger protein 109, RNF109, TRIM

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below

Product Information

25509-1-AP targets TRIM56 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21992

  Product name: Recombinant human TRIM56 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-258 aa of BC048194

  Sequence: MVSHGSSPSLLEALSSDFLACKICLEQLRAPKTLPCLHTYCQDCLAQLADGGRVRCPECRETVPVPPEGVASFKTNFFVNGLLDLVKARACGDLRAGKPACALCPLVGGTSTGGPATARCLDCADDLCQACADGHRCTRQTHTHRVVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFLCQPCSQLLCRECRLDPHLDHPCLPLAEAVRARRPGLEGLLAGVDNNLVELEAARRVEKEALARLREQAARVGTQVEEA

• Full Name: tripartite motif-containing 56
• Calculated Molecular Weight: 755 aa, 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC048194
• Gene Symbol: TRIM56
• Gene ID (NCBI): 81844
• RRID: AB_3085800
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRZ2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; Key Roles for Phosphorylation and the Coiled-coil Domain in TRIM56-mediated Positive Regulation of TLR3-TRIF-dependent Innate Immunity; Authors - Benjamin M Liu
human	WB	Adv Sci (Weinh); PRDX6 Prevents NNMT Ubiquitination and Degradation as a Nonenzymatic Mechanism to Promote Ovarian Cancer Progression; Authors - Xingyun Wu ; KD Validated
human	WB	Cell Rep; Lactylation orchestrates ubiquitin-independent degradation of cGAS and promotes tumor growth; Authors - Keqiang Rao ; KD Validated
human	WB	J Virol; TRIM56 enhances adenoviral E1A steady state to improve oncolytic adenovirus therapy efficacy; Authors - Nan Sun