TRIM58 Polyclonal antibody, PBS Only

• 

  WB analysis using 28725-1-AP (same clone as 28725-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28725-1-AP (TRIM58 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28725-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 28725-1-AP (same clone as 28725-1-PBS)

  WB result of TRIM58 antibody (28725-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRIM58 transfected PC-3 cells. This data was developed using the same antibody clone with 28725-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRIM58 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28725-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

BIA2, Protein BIA2, TRIM, tripartite motif containing 58

---

Product Information

28725-1-PBS targets TRIM58 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30014

  Product name: Recombinant human TRIM58 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 120-330 aa of NM_015431

  Sequence: AGPEHRTHRTAPLQEAAGSYQVKLQMALELMRKELEDALTQEANVGKKTVIWKEKVEMQRQRFRLEFEKHRGFLAQEEQRQLRRLEAEERATLQRLRESKSRLVQQSKALKELADELQERCQRPALGLLEGVRGVLSRSKAVTRLEAENIPMELKTACCIPGRRELLRKFQVDVKLDPATAHPSLLLTADLRSVQDGEPWRDVPNNPERFD

• Full Name: tripartite motif-containing 58
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: NM_015431
• Gene Symbol: TRIM58
• Gene ID (NCBI): 25893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NG06
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRIM58 (Tripartite motif-containing protein 58) is an E3 ubiquitin ligase induced during late erythropoiesis. It can directly bind and ubiquitinate the intermediate chain of the microtubule motor dynein (DYNC1LI1/DYNC1LI2), stimulating the degradation of the dynein holoprotein complex. May participate in the erythroblast enucleation process through regulation of nuclear polarization (PMID: 25241935).