TRIM69 Polyclonal antibody

• 

  WB analysis using 29907-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29907-1-AP (TRIM69 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 29907-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29907-1-AP (TRIM69 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 29907-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29907-1-AP (TRIM69 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TRIM69 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29907-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse

Applications

WB, IHC, ELISA

Synonyms

HSD 34, HSD34, RING finger protein 36, RNF36, Trif, TRIM69, tripartite motif containing 69

---

Tested Applications

• Positive WB detected in: K-562 cells, SH-SY5Y cells
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29907-1-AP targets TRIM69 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31775

  Product name: Recombinant human TRIM69 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-190 aa of BC033314

  Sequence: MEEELAIQQGQLETTLKELQTLRNMQKEAIAAHKENKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEGKALNEEMELNLSQLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGD

• Full Name: tripartite motif-containing 69
• Calculated Molecular Weight: 500 aa, 57 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC033314
• Gene Symbol: TRIM69
• Gene ID (NCBI): 140691
• RRID: AB_2935487
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86WT6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

E3 ubiquitin-protein ligase TRIM69 (TRIM69) plays an important role in antiviral immunity by restricting different viral infections including dengue virus or vesicular stomatitis Indiana virus (PubMed:31375575, PubMed:31578292). It plays also a role in cataract formation together with TP53 (PubMed:30844644). Mechanistically, inhibits UVB-induced cell apoptosis and reactive oxygen species (ROS) production by inducing TP53 ubiquitination (PubMed:30844644). It has 4 isoforms with molecular weights of 57, 39, 34, and 32 kDa.