TRIO Polyclonal antibody, PBS Only

• 

  WB analysis using 31192-1-AP (same clone as 31192-1-PBS)

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 31192-1-AP (TRIO antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31192-1-PBS in a different storage buffer formulation.

TRIO Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31192-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

tgat

---

Product Information

31192-1-PBS targets TRIO in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34954

  Product name: Recombinant human TRIO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2551-2680 aa of NM_007118

  Sequence: SNISTMLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPNYI

• Full Name: triple functional domain (PTPRF interacting)
• Calculated Molecular Weight: 347 kDa
• Observed Molecular Weight: 347 kDa
• GenBank Accession Number: NM_007118
• Gene Symbol: TRIO
• Gene ID (NCBI): 7204
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75962
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.