TRIP4 Polyclonal antibody, PBS Only

• 

  WB analysis of HL-60 using 12324-1-AP (same clone as 12324-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 12324-1-AP (TRIP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12324-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12324-1-AP (same clone as 12324-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12324-1-AP (TRIP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12324-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 12324-1-AP (same clone as 12324-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 12324-1-AP (TRIP4 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12324-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12324-1-AP (same clone as 12324-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12324-1-AP (TRIP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12324-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 12324-1-AP (same clone as 12324-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 12324-1-AP (TRIP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 12324-1-AP (same clone as 12324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12324-1-AP (TRIP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 12324-1-AP (same clone as 12324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12324-1-AP (TRIP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 12324-1-AP (same clone as 12324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12324-1-AP (TRIP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 12324-1-AP (same clone as 12324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12324-1-AP (TRIP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12324-1-PBS in a different storage buffer formulation.

TRIP4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12324-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ASC 1, ASC-1, HsT17391, RQT4, Thyroid receptor-interacting protein 4

---

Product Information

12324-1-PBS targets TRIP4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2987

  Product name: Recombinant human TRIP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 281-581 aa of BC012448

  Sequence: QVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGTLNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQLRIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV

• Full Name: thyroid hormone receptor interactor 4
• Calculated Molecular Weight: 581 aa, 66 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC012448
• Gene Symbol: TRIP4
• Gene ID (NCBI): 9325
• RRID: AB_10646482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15650
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Thyroid hormone receptor interactor 4(TRIP4), other named ASC1, is a transcriptional coactivator that promote transcriptional efficiencies. It harbors an autonomous transactivation domain that contains a putative zinc finger motif, which serves as a binding site for nuclear receptors for thyroid, estrogen, all-trans-retinoic acid and RXR by interaction with SRC-1 or CBP/p300. There are two forms of ASC1 have been detected in mRNA level, isoform1(581aa, ~65kd) and isoform2(539aa,~60kd)(12077347,12390891)