TRMT112 Polyclonal antibody

• 

  WB analysis using 26472-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26472-1-AP (TRMT112 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 26472-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 26472-1-AP (TRMT112 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 26472-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 26472-1-AP (TRMT112 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TRMT112 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26472-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

HSPC152, HSPC170, hypothetical protein HSPC152, TRM112 like protein, TRMT112

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells, PC-3 cells, SH-SY5Y cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26472-1-AP targets TRMT112 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24126

  Product name: Recombinant human HSPC152 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-125 aa of BC017172

  Sequence: NFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES

• Full Name: hypothetical protein HSPC152
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC017172
• Gene Symbol: TRMT112
• Gene ID (NCBI): 51504
• RRID: AB_3085875
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UI30
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRMT112 is a small evolutionarily conserved protein that acts as a co-factor and activator for different MTases involved in rRNA, tRNA and protein methylation. The TRMT112 interaction with 18S rRNA MTases WBSCR22 (BUD23, MERM1) and METTL5 is required for their metabolic stability and enzymatic activity in cells. (PMID: 34948388, PMID: 34948388)

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Nathalie (Verified Customer) (09-26-2025)

Worked on blot with incubation o/n

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HCT116 cells

TRMT112 Antibody Western Blot validation (1:1000 dilution) in HCT116 cells (Cat no:26472-1-AP)