TRNAU1AP,SECP43 Polyclonal antibody, PBS Only

• 

  WB analysis using 15053-1-AP (same clone as 15053-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15053-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15053-1-AP (same clone as 15053-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15053-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 15053-1-AP (same clone as 15053-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15053-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 15053-1-AP (same clone as 15053-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15053-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 15053-1-AP (same clone as 15053-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15053-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 15053-1-AP (same clone as 15053-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15053-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 15053-1-AP (same clone as 15053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15053-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 15053-1-AP (same clone as 15053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15053-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRNAU1AP,SECP43 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15053-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15053-1-PBS targets TRNAU1AP,SECP43 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7036

  Product name: Recombinant human TRNAU1AP,SECP43 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-287 aa of BC000680

  Sequence: MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM

• Full Name: tRNA selenocysteine 1 associated protein 1
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 36 kDa, 21 kDa
• GenBank Accession Number: BC000680
• Gene Symbol: SECP43
• Gene ID (NCBI): 54952
• RRID: AB_10644291
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX07
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.