TRNAU1AP,SECP43 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRNAU1AP,SECP43 Polyclonal antibody (15053-1-AP)

• Featured Product
• KD/KO Validated

TRNAU1AP,SECP43 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15053-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

TRNAU1AP, SECp43, tRNA selenocysteine 1-associated protein 1, tRNA selenocysteine-associated protein 1, TRSPAP1

• 

  WB analysis using 15053-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15053-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 15053-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 15053-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 15053-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 15053-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 15053-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 15053-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRNAU1AP,SECP43 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells, MCF-7 cells, COLO 320 cells
• Positive IHC detected in: human hepatocirrhosis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15053-1-AP targets TRNAU1AP,SECP43 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7036

  Product name: Recombinant human TRNAU1AP,SECP43 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-287 aa of BC000680

  Sequence: MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM

• Full Name: tRNA selenocysteine 1 associated protein 1
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 36 kDa, 21 kDa
• GenBank Accession Number: BC000680
• Gene Symbol: SECP43
• Gene ID (NCBI): 54952
• RRID: AB_10644291
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX07
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-Trnau1ap antibody (Cat# 15053-1-AP) has 4 total citations published in Molecular Medicine Reports, Biological Trace Element Research (×2), and Biochemical and Biophysical Research Communications. Research fields include cardiomyocyte proliferation and apoptosis, renal fibrosis and Wnt/β-catenin signaling, mitochondrial biogenesis in selenium deficiency, and inhibition of cell proliferation/migration via the PI3K/Akt pathway. All citations used Western blot as the application.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Mol Med Rep; Role of tRNA selenocysteine 1 associated protein 1 in the proliferation and apoptosis of cardiomyocyte‑like H9c2 cells.; Authors - Meng-Di Li ; KD Validated
mouse	WB	Biol Trace Elem Res; Selenium Deficiency-Induced Damage and Altered Expression of Mitochondrial Biogenesis Markers in the Kidneys of Mice.; Authors - Hehuan Lai
mouse	WB	Biol Trace Elem Res; Selenium Deficiency Leads to Changes in Renal Fibrosis Marker Proteins and Wnt/β-Catenin Signaling Pathway Components.; Authors - Tingting Lin
mouse,human	WB	Biochem Biophys Res Commun; Knockdown of Trnau1ap inhibits the proliferation and migration of NIH3T3, JEG-3 and Bewo cells via the PI3K/Akt signaling pathway.; Authors - Xiaoyan Hu