TRNAU1AP,SECP43 Polyclonal antibody

• 

  WB analysis using 15053-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 15053-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 15053-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 15053-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 15053-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15053-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human hepatocirrhosis using 15053-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 15053-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15053-1-AP (TRNAU1AP,SECP43 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

TRNAU1AP,SECP43 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15053-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

PRO1902, RP4 669K10.4, SECP43, TRNAU1AP, TRNAU1AP,SECP43, TRSPAP1

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells, MCF-7 cells, COLO 320 cells
• Positive IHC detected in: human hepatocirrhosis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below

Product Information

15053-1-AP targets TRNAU1AP,SECP43 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7036

  Product name: Recombinant human TRNAU1AP,SECP43 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-287 aa of BC000680

  Sequence: MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM

• Full Name: tRNA selenocysteine 1 associated protein 1
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 36 kDa, 21 kDa
• GenBank Accession Number: BC000680
• Gene Symbol: SECP43
• Gene ID (NCBI): 54952
• RRID: AB_10644291
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX07
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Biochem Biophys Res Commun; Knockdown of Trnau1ap inhibits the proliferation and migration of NIH3T3, JEG-3 and Bewo cells via the PI3K/Akt signaling pathway.; Authors - Xiaoyan Hu
mouse	WB	Biol Trace Elem Res; Selenium Deficiency Leads to Changes in Renal Fibrosis Marker Proteins and Wnt/β-Catenin Signaling Pathway Components.; Authors - Tingting Lin
mouse	WB	Biol Trace Elem Res; Selenium Deficiency-Induced Damage and Altered Expression of Mitochondrial Biogenesis Markers in the Kidneys of Mice.; Authors - Hehuan Lai
rat	WB	Mol Med Rep; Role of tRNA selenocysteine 1 associated protein 1 in the proliferation and apoptosis of cardiomyocyte‑like H9c2 cells.; Authors - Meng-Di Li ; KD Validated