TRPS1 Polyclonal antibody

• 

  WB analysis using 28753-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28753-1-AP (TRPS1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 28753-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 28753-1-AP (TRPS1 antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 28753-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 28753-1-AP (TRPS1 antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TRPS1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28753-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Tricho-rhino-phalangeal syndrome type I protein, LGCR, GC79

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:800-1:3200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28753-1-AP targets TRPS1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30188

  Product name: Recombinant human TRPS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1158-1281 aa of NM_014112

  Sequence: SDNDIPLDLAIKHSRPGPTANGASKEKTKAPPNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE

• Full Name: trichorhinophalangeal syndrome I
• Calculated Molecular Weight: 142 kDa
• Observed Molecular Weight: 142 kDa
• GenBank Accession Number: NM_014112
• Gene Symbol: TRPS1
• Gene ID (NCBI): 7227
• RRID: AB_2881209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHF7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRPS1 is a zinc finger transcriptional repressor involved in the regulation of chondrocyte and perichondrium development, containing a GATA-type zinc finger through which it binds to DNA. with nine zinc-finger domains and two C-terminal Ikaros-like zinc fingers. Its reperssible function was dependent on the integrity of the Trps1 GATA-type zinc-finger domain and also required the C-terminal 119 amino acids of the protein, which harbor the two Ikaros-like zinc-finger domains