Tested Applications
Positive WB detected in | HeLa cells, MCF-7 cells |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:800-1:3200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
28753-1-AP targets TRPS1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30188 Product name: Recombinant human TRPS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1158-1281 aa of NM_014112 Sequence: SDNDIPLDLAIKHSRPGPTANGASKEKTKAPPNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE Predict reactive species |
Full Name | trichorhinophalangeal syndrome I |
Calculated Molecular Weight | 142 kDa |
Observed Molecular Weight | 142 kDa |
GenBank Accession Number | NM_014112 |
Gene Symbol | TRPS1 |
Gene ID (NCBI) | 7227 |
RRID | AB_2881209 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9UHF7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRPS1 is a zinc finger transcriptional repressor involved in the regulation of chondrocyte and perichondrium development, containing a GATA-type zinc finger through which it binds to DNA. with nine zinc-finger domains and two C-terminal Ikaros-like zinc fingers. Its reperssible function was dependent on the integrity of the Trps1 GATA-type zinc-finger domain and also required the C-terminal 119 amino acids of the protein, which harbor the two Ikaros-like zinc-finger domains
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TRPS1 antibody 28753-1-AP | Download protocol |
IHC protocol for TRPS1 antibody 28753-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |