Tested Applications
Positive WB detected in | human placenta tissue, mouse kidney tissue, PC-3 cells |
Positive IP detected in | mouse kidney tissue |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 9 publications below |
IF | See 5 publications below |
Product Information
13411-1-AP targets TRPV6 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4060 Product name: Recombinant human TRPV6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC034814 Sequence: MYVENHCSRPALLLQLWGRGSPAQARGWQGVRNSPVACSSPFRQEHCMSEHFKNRPACLGARSPPQGHKWGESPSQGTQAGAGKCRACGKRVSEGDRNGSGGGKWG Predict reactive species |
Full Name | transient receptor potential cation channel, subfamily V, member 6 |
Calculated Molecular Weight | 725 aa, 83 kDa |
Observed Molecular Weight | 83 kDa, 70 kDa |
GenBank Accession Number | BC034814 |
Gene Symbol | TRPV6 |
Gene ID (NCBI) | 55503 |
RRID | AB_2272390 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H1D0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRPV6, also named as CAT1 or ECaC2, is a member of the transient receptor potential (TRP) family of membrane proteins. Unlike most TRP channels, TRPV6 and its closest relative, TRPV5, are calcium-selective channels. TRPV6 is highly expressed in the proximal intestine, placenta and exocrine tissues (PMID: 12869611). It is probably involved in calcium absorption in various tissues, including calcium reabsorption in kidney. TRPV6 is overexpressed in some cancers and exhibits oncogenic potential.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TRPV6 antibody 13411-1-AP | Download protocol |
IF protocol for TRPV6 antibody 13411-1-AP | Download protocol |
IP protocol for TRPV6 antibody 13411-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Mol Cell Cardiol TRPV6 protects ER stress-induced apoptosis via ATF6α-TRPV6-JNK pathway in human embryonic stem cell-derived cardiomyocytes. | ||
Front Pharmacol Aqueous Extract of Mori Folium Exerts Bone Protective Effect Through Regulation of Calcium and Redox Homeostasis via PTH/VDR/CaBP and AGEs/RAGE/Nox4/NF-κB Signaling in Diabetic Rats. | ||
J Gastroenterol Hepatol Vitamin D receptor is overexpressed in the duodenum of patients with irritable bowel syndrome. | ||
Ann Transl Med Rosavin suppresses osteoclastogenesis in vivo and in vitro by blocking the nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) and mitogen-activated protein kinase (MAPK) signaling pathways. |