TRPV6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRPV6 Polyclonal antibody (13411-1-AP)

TRPV6 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 13411-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IF/ICC, IP, ELISA

Synonyms

ABP/ZF, Calcium transport protein 1, CaT L, CaT like, CaT1

• 

  WB analysis of human placenta using 13411-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13411-1-AP (TRPV6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 13411-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13411-1-AP (TRPV6 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 13411-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13411-1-AP (TRPV6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 13411-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13411-1-AP (TRPV6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 13411-1-AP

  IP result of anti-TRPV6 (IP:13411-1-AP, 4ug; Detection:13411-1-AP 1:300) with mouse kidney tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13411-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TRPV6 antibody (13411-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRPV6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human placenta tissue, mouse kidney tissue, PC-3 cells
• Positive IP detected in: mouse kidney tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13411-1-AP targets TRPV6 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4060

  Product name: Recombinant human TRPV6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-106 aa of BC034814

  Sequence: MYVENHCSRPALLLQLWGRGSPAQARGWQGVRNSPVACSSPFRQEHCMSEHFKNRPACLGARSPPQGHKWGESPSQGTQAGAGKCRACGKRVSEGDRNGSGGGKWG

• Full Name: transient receptor potential cation channel, subfamily V, member 6
• Calculated Molecular Weight: 725 aa, 83 kDa
• Observed Molecular Weight: 83 kDa, 70 kDa
• GenBank Accession Number: BC034814
• Gene Symbol: TRPV6
• Gene ID (NCBI): 55503
• RRID: AB_2272390
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1D0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRPV6, also named as CAT1 or ECaC2, is a member of the transient receptor potential (TRP) family of membrane proteins. Unlike most TRP channels, TRPV6 and its closest relative, TRPV5, are calcium-selective channels. TRPV6 is highly expressed in the proximal intestine, placenta and exocrine tissues (PMID: 12869611). It is probably involved in calcium absorption in various tissues, including calcium reabsorption in kidney. TRPV6 is overexpressed in some cancers and exhibits oncogenic potential.

Publications

What published studies show

TRPV6 antibody (Cat# 13411-1-AP) has 16 citations across journals including Cancer Letters, EBioMedicine, Molecular Cancer Research, Frontiers in Pharmacology, FASEB Journal, iScience, and others. Research fields span oncology (cholangiocarcinoma, breast cancer, cervical cancer), intestinal barrier biology, bone metabolism and osteoporosis, cardiovascular protection, neuroinflammation, calcium signaling, diabetes, reproductive health, and otology. Applications include Western blot and immunofluorescence in human, mouse, and pig models.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Lett; Lidocaine potentiates thermal ablation in cholangiocarcinoma by modulating TRPV6-Driven Ca(2+)/PI3K/AKT/HSF-1 signaling pathway.; Authors - Ping-Ping Chen ; KD Validated
mouse	WB,IF	EBioMedicine; Intestinal epithelial β Klotho is a critical protective factor in alcohol-induced intestinal barrier dysfunction and liver injury.; Authors - Zhengping Hou
human	WB,IF	Mol Cancer Res; PMID: 19996302; Authors - Bolanz Katrin A KA
pig		Int J Mol Sci; Integrating Transcriptomics and Proteomics to Characterize the Intestinal Responses to Cadmium Exposure Using a Piglet Model; Authors - Yikun Li
mouse	WB,IF	Front Pharmacol; Wubi Shanyao pills ameliorate diet-induced postmenopausal osteoporosis in mice by enhancing calcium absorption.; Authors - Xiaorui Su
mouse	WB	Front Pharmacol; Aqueous Extract of Mori Folium Exerts Bone Protective Effect Through Regulation of Calcium and Redox Homeostasis via PTH/VDR/CaBP and AGEs/RAGE/Nox4/NF-κB Signaling in Diabetic Rats.; Authors - Chenyue Liu