TRPV6 Polyclonal antibody, PBS Only

• 

  WB analysis using 31045-1-AP (same clone as 31045-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31045-1-AP (TRPV6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31045-1-PBS in a different storage buffer formulation.

TRPV6 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31045-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31045-1-PBS targets TRPV6 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34052

  Product name: Recombinant human TRPV6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 670-765 aa of NM_018646

  Sequence: FLRVEDRQDLNRQRIQRYAQAFHTRGSEDLDKDSVEKLELGCPFSPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQI*

• Full Name: transient receptor potential cation channel, subfamily V, member 6
• Calculated Molecular Weight: 87KD
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: NM_018646
• Gene Symbol: TRPV6
• Gene ID (NCBI): 55503
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1D0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRPV6, also named as CAT1 or ECaC2, is a member of the transient receptor potential (TRP) family of membrane proteins. Unlike most TRP channels, TRPV6 and its closest relative, TRPV5, are calcium-selective channels. TRPV6 is highly expressed in the proximal intestine, placenta and exocrine tissues (PMID: 12869611). It is probably involved in calcium absorption in various tissues, including calcium reabsorption in kidney. TRPV6 is overexpressed in some cancers and exhibits oncogenic potential.