Product Information
31045-1-PBS targets TRPV6 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag34052 Product name: Recombinant human TRPV6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 670-765 aa of NM_018646 Sequence: FLRVEDRQDLNRQRIQRYAQAFHTRGSEDLDKDSVEKLELGCPFSPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQI* Predict reactive species |
Full Name | transient receptor potential cation channel, subfamily V, member 6 |
Calculated Molecular Weight | 87KD |
Observed Molecular Weight | 75 kDa |
GenBank Accession Number | NM_018646 |
Gene Symbol | TRPV6 |
Gene ID (NCBI) | 55503 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H1D0 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
TRPV6, also named as CAT1 or ECaC2, is a member of the transient receptor potential (TRP) family of membrane proteins. Unlike most TRP channels, TRPV6 and its closest relative, TRPV5, are calcium-selective channels. TRPV6 is highly expressed in the proximal intestine, placenta and exocrine tissues (PMID: 12869611). It is probably involved in calcium absorption in various tissues, including calcium reabsorption in kidney. TRPV6 is overexpressed in some cancers and exhibits oncogenic potential.