Tested Applications
| Positive WB detected in | HeLa cells, mouse kidney tissue, MCF-7 cells |
| Positive IHC detected in | mouse kidney tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | hTERT-RPE1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IHC | See 2 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
29906-1-AP targets Hamartin/TSC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31621 Product name: Recombinant human TSC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 965-1164 aa of NM_000368 Sequence: LYGRLEKDGLLKKLEEEKAEAAEAAEERLDCCNDGCSDSMVGHNEEASGHNGETKTPRPSSARGSSGSRGGGGSSSSSSELSTPEKPPHQRAGPFSSRWETTMGEASASIPTTVGSLPSSKSFLGMKARELFRNKSESQCDEDGMTSSLSESLKTELGKDLGVEAKIPLNLDGPHPSPPTPDSVGQLHIMDYNETHHEHS Predict reactive species |
| Full Name | tuberous sclerosis 1 |
| Calculated Molecular Weight | 130KD |
| Observed Molecular Weight | 140-145 kDa |
| GenBank Accession Number | NM_000368 |
| Gene Symbol | Hamartin/TSC1 |
| Gene ID (NCBI) | 7248 |
| RRID | AB_2918352 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92574 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TSC1, also named as hamartin, interacts with TSC2 to form a protein complex that inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling (PubMed: 12271141, PubMed: 28215400). It can recruit TSC2 to HSP90AA1 and stabilizes TSC2 by preventing the interaction between TSC2 and ubiquitin ligase HERC1 (PubMed: 16464865, PubMed: 29127155). The loss of TSC1/TSC2 in mouse neurons resulted in a block in oligodendrocyte hypomyelination in vivo (PubMed: 28183733).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Hamartin/TSC1 antibody 29906-1-AP | Download protocol |
| IHC protocol for Hamartin/TSC1 antibody 29906-1-AP | Download protocol |
| WB protocol for Hamartin/TSC1 antibody 29906-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Genes Dis Naked cuticle homolog 2 controls the differentiation of osteoblasts and osteoclasts and ameliorates bone loss in ovariectomized mice | ||
J Orthop Surg Res Regulating osteogenic differentiation of bone marrow mesenchymal stem cells by mTORC1 signaling pathway inhibits bone defect repair in mice.
| ||
J Transl Med Polystyrene nanoplastics trigger pyroptosis in dopaminergic neurons through TSC2/TFEB-mediated disruption of autophagosome-lysosome fusion in Parkinson's disease | ||
Elife A cleaved METTL3 potentiates the METTL3-WTAP interaction and breast cancer progression | ||
Cell Signal METTL14-mediated N6-methyladenosine modification of TCP1 mRNA promotes acute myeloid leukemia progression | ||
Br J Cancer CDK4/6 inhibitors dephosphorylate RNF26 to stabilize TSC1 and increase the sensitivity of ccRCC to mTOR inhibitors |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Shivali (Verified Customer) (09-13-2025) | We are working on how negative regulators of mTOR complex affect translation and used this antibody to check TSC1 knockout cell lines. Worked well
|
FH Parijat (Verified Customer) (08-27-2025) | I used this antibody to confirm TSC2 knockout in both human (eHap1) and mouse (IMCD3) cells and it worked great. Although in Mouse there were few non-specific bands, it was much cleaner in Human cells.
|













