Tested Applications
| Positive WB detected in | mouse lung tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below | 
| WB | See 1 publications below | 
| IF | See 1 publications below | 
Product Information
18974-1-AP targets TSPAN13 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag6997 Product name: Recombinant human TSPAN13 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 100-204 aa of BC033863 Sequence: NQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL Predict reactive species | 
                                    
| Full Name | tetraspanin 13 | 
| Calculated Molecular Weight | 204 aa, 22 kDa | 
| Observed Molecular Weight | 28-35 kDa | 
| GenBank Accession Number | BC033863 | 
| Gene Symbol | TSPAN13 | 
| Gene ID (NCBI) | 27075 | 
| RRID | AB_10596633 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | O95857 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TSPAN13 antibody 18974-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 



