Tested Applications
| Positive WB detected in | rat heart tissue, HeLa cells, HepG2 cells, mouse skeletal muscle tissue, PC-3 cells |
| Positive IHC detected in | human skeletal muscle tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 2 publications below |
Product Information
21987-1-AP targets TSPAN31 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17138 Product name: Recombinant human TSPAN31 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 91-180 aa of BC010377 Sequence: VISCSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGL Predict reactive species |
| Full Name | tetraspanin 31 |
| Calculated Molecular Weight | 210 aa, 23 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC010377 |
| Gene Symbol | TSPAN31 |
| Gene ID (NCBI) | 6302 |
| RRID | AB_2878962 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12999 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tetraspanin-31 (TSPAN31) belongs to the tetraspanin (TM4SF) family, also known as the transmembrane 4 (TM4) superfamily, which is a family of transmembrane proteins with 33 mammalian members. These proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth, and motility. Tetraspanin-31 is thought to be involved in growth-related cellular processes. The experimentally determined molecular mass of 30 kDa is larger than the calculated molecular mass of 23 kDa, which could be a result of post-translational modifications.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TSPAN31 antibody 21987-1-AP | Download protocol |
| WB protocol for TSPAN31 antibody 21987-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Carcinog TSPAN31 Activates Fatty Acid Metabolism and PI3K/AKT Pathway to Promote Tumor Progression in Breast Cancer | ||
Cancer Sci Overexpression of Tetraspanin31 contributes to malignant potential and poor outcomes in gastric cancer |

















