TSPAN31 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TSPAN31 Polyclonal antibody (21987-1-AP)

TSPAN31 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21987-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Sarcoma-amplified sequence, SAS, Tetraspanin-31, Tspan-31

• 

  WB analysis of HeLa using 21987-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21987-1-AP (TSPAN31 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 21987-1-AP

  Rat heart tissue was subjected to SDS PAGE followed by western blot with 21987-1-AP (TSPAN31 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 21987-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21987-1-AP (TSPAN31 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 21987-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 21987-1-AP (TSPAN31 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 21987-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 21987-1-AP (TSPAN31 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 21987-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 21987-1-AP (TSPAN31 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 21987-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 21987-1-AP (TSPAN31 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 21987-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 21987-1-AP (TSPAN31 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 21987-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 21987-1-AP (TSPAN31 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TSPAN31 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat heart tissue, HeLa cells, HepG2 cells, mouse skeletal muscle tissue, PC-3 cells
• Positive IHC detected in: human skeletal muscle tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21987-1-AP targets TSPAN31 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17138

  Product name: Recombinant human TSPAN31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 91-180 aa of BC010377

  Sequence: VISCSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGL

• Full Name: tetraspanin 31
• Calculated Molecular Weight: 210 aa, 23 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC010377
• Gene Symbol: TSPAN31
• Gene ID (NCBI): 6302
• RRID: AB_2878962
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12999
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tetraspanin-31 (TSPAN31) belongs to the tetraspanin (TM4SF) family, also known as the transmembrane 4 (TM4) superfamily, which is a family of transmembrane proteins with 33 mammalian members. These proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth, and motility. Tetraspanin-31 is thought to be involved in growth-related cellular processes. The experimentally determined molecular mass of 30 kDa is larger than the calculated molecular mass of 23 kDa, which could be a result of post-translational modifications.

Publications

What published studies show

The anti-TSPAN31 antibody (catalog #21987-1-AP) has 2 total citations. These appear in Cancer Science (IF 4.9) and Molecular Carcinogenesis (IF 3.5). Both studies focus on oncology, specifically investigating TSPAN31's role in gastric cancer malignant potential and breast cancer tumor progression via fatty acid metabolism and PI3K/AKT pathway activation. Applications include IHC and WB in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cancer Sci; Overexpression of Tetraspanin31 contributes to malignant potential and poor outcomes in gastric cancer; Authors - Yusuke Takashima
human	WB,IHC	Mol Carcinog; TSPAN31 Activates Fatty Acid Metabolism and PI3K/AKT Pathway to Promote Tumor Progression in Breast Cancer; Authors - Wenquan Luo