Tested Applications
| Positive WB detected in | HepG2 cells, PC-12 cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20319-1-AP targets TSPAN8 in WB, IHC, IP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14173 Product name: Recombinant human TSPAN8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 97-217 aa of BC005246 Sequence: LLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGIAFGLA Predict reactive species |
| Full Name | tetraspanin 8 |
| Calculated Molecular Weight | 237 aa, 26 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC005246 |
| Gene Symbol | TSPAN8 |
| Gene ID (NCBI) | 7103 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19075 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TSPAN8 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN8 and CD151 coordinately promote metastasis, where Tspan8 overrides the adhesive features of CD151 by recruiting integrins out of adhesion into motility promoting complexes (PMID: 23683890). TSPAN8 contributes to molecular pathways of exosome-induced endothelial cell activation (PMID: 20124479).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TSPAN8 antibody 20319-1-AP | Download protocol |
| IP protocol for TSPAN8 antibody 20319-1-AP | Download protocol |
| WB protocol for TSPAN8 antibody 20319-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



