TSPY3 Polyclonal antibody, PBS Only

• 

  WB analysis of human testis using 22257-1-AP (same clone as 22257-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 22257-1-AP (TSPY3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22257-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 22257-1-AP (same clone as 22257-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 22257-1-AP (TSPY3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 22257-1-AP (same clone as 22257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 22257-1-AP (TSPY3 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 22257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 22257-1-AP (same clone as 22257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 22257-1-AP (TSPY3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 22257-1-AP (same clone as 22257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 22257-1-AP (TSPY3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 22257-1-AP (same clone as 22257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 22257-1-AP (TSPY3 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 22257-1-PBS in a different storage buffer formulation.

TSPY3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22257-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

22257-1-PBS targets TSPY3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17762

  Product name: Recombinant human TSPY3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-308 aa of BC075016

  Sequence: MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS

• Full Name: testis specific protein, Y-linked 3
• Calculated Molecular Weight: 308 aa, 35 kDa
• Observed Molecular Weight: 39-40 kDa
• GenBank Accession Number: BC075016
• Gene Symbol: TSPY3
• Gene ID (NCBI): 728137
• RRID: AB_11182707
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0CV98
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.