TUBG2 Polyclonal antibody, PBS Only

• 

  WB analysis using 28009-1-AP (same clone as 28009-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28009-1-AP (TUBG2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28009-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28009-1-AP (same clone as 28009-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28009-1-AP (TUBG2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28009-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 28009-1-AP (same clone as 28009-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28009-1-AP (TUBG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28009-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 28009-1-AP (same clone as 28009-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TUBG2 antibody (28009-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 28009-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 28009-1-AP (same clone as 28009-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human TUBG2 (28009-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 28009-1-PBS in a different storage buffer formulation.

TUBG2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 28009-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

---

Product Information

28009-1-PBS targets TUBG2 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27728

  Product name: Recombinant human TUBG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 358-451 aa of BC051890

  Sequence: VALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYISWGTQEQ

• Full Name: tubulin, gamma 2
• Calculated Molecular Weight: 451 aa, 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC051890
• Gene Symbol: TUBG2
• Gene ID (NCBI): 27175
• RRID: AB_2918138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRH3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.