Tested Applications
Positive WB detected in | mouse cerebellum tissue, HeLa cells, T-47D cells, rat cerebellum tissue |
Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
28009-1-AP targets TUBG2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27728 Product name: Recombinant human TUBG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 358-451 aa of BC051890 Sequence: VALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYISWGTQEQ Predict reactive species |
Full Name | tubulin, gamma 2 |
Calculated Molecular Weight | 451 aa, 51 kDa |
Observed Molecular Weight | 51 kDa |
GenBank Accession Number | BC051890 |
Gene Symbol | TUBG2 |
Gene ID (NCBI) | 27175 |
RRID | AB_2918138 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NRH3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TUBG2 antibody 28009-1-AP | Download protocol |
IHC protocol for TUBG2 antibody 28009-1-AP | Download protocol |
IF protocol for TUBG2 antibody 28009-1-AP | Download protocol |
FC protocol for TUBG2 antibody 28009-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |