Published Applications
WB | See 2 publications below |
IHC | See 2 publications below |
IF | See 1 publications below |
Product Information
11538-1-AP targets TUSC2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2118 Product name: Recombinant human TUSC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC023976 Sequence: MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV Predict reactive species |
Full Name | tumor suppressor candidate 2 |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 10-12 kDa |
GenBank Accession Number | BC023976 |
Gene Symbol | TUSC2 |
Gene ID (NCBI) | 11334 |
RRID | AB_10699869 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75896 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FUS1 (or TUSC2) gene is a highly conserved lung cancer candidate gene, which was identified in the 120 kb 3p21.3 critical region contained in nested lung and breast cancer homozygous deletions. Overexpression of FUS1 gene leads to G1 arrest and growth inhibition of lung cancer cells (PMID: 11593436). The encoded Fusion-1 protein was down-regulated, mutated or lost in the majority of inflammatory thoracic malignancies. It has been evidenced that Fusion-1 establishes its immune- and tumour-suppressive activities via regulation of mitochondrial homeostasis (PMID: 22513871). In addition, myristoylation is found to be required for Fusion-1-mediated tumor-suppressing activity and suggest a novel mechanism for the inactivation of tumor suppressors in lung cancer and a role for deficient posttranslational modification in tumor suppressor-gene-mediated carcinogenesis (PMID: 15126327).