TWEAKR/CD266 Recombinant monoclonal antibody, PBS Only (Capture)

TWEAKR/CD266 Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83916-1-PBS
Clone No.240991B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

CD266, TNFRSF12A, TweakR, FGF inducible 14, DR3LG

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83916-1-PBS targets TWEAKR/CD266 as part of a matched antibody pair:

MP00861-1: 83916-1-PBS capture and 83916-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13823

Product name: Recombinant human TWEAKR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 19-91 aa of BC002718

Sequence: LALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFV

Predict reactive species
Full Name tumor necrosis factor receptor superfamily, member 12A
Calculated Molecular Weight 129 aa, 14 kDa
GenBank Accession NumberBC002718
Gene Symbol TWEAKR
Gene ID (NCBI) 51330
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NP84
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TweakR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TweakR expression by other growth factors and/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185)

Loading...
||
New chat Able
正在加载,请稍候...