CoraLite®594 Anti-Human TWEAKR/CD266 Rabbit Recombinant Antibody

TWEAKR/CD266 Uni-rAb® Recombinant Antibody for FC

Cat No. CL594-98125
Clone No.240991C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

CD266, TNFRSF12A, TweakR, 240991C5, APO3L

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inHT-1080 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98125 targets TWEAKR/CD266 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13823

Product name: Recombinant human TWEAKR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 19-91 aa of BC002718

Sequence: LALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFV

Predict reactive species
Full Name tumor necrosis factor receptor superfamily, member 12A
Calculated Molecular Weight 129 aa, 14 kDa
GenBank Accession NumberBC002718
Gene Symbol TWEAKR
Gene ID (NCBI) 51330
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NP84
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TweakR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TweakR expression by other growth factors and/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185)

Protocols

Product Specific Protocols
FC protocol for CL594 TWEAKR/CD266 antibody CL594-98125Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...