Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
27558-1-AP targets Alpha Taxilin in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23001 Product name: Recombinant human TXLNA protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 477-546 aa of BC103823 Sequence: ERNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQEPTSARA Predict reactive species |
Full Name | taxilin alpha |
Calculated Molecular Weight | 546 aa, 62 kDa |
Observed Molecular Weight | 75 kDa |
GenBank Accession Number | BC103823 |
Gene Symbol | Alpha Taxilin |
Gene ID (NCBI) | 200081 |
RRID | AB_2880907 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P40222 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Alpha-taxilin is a member of the taxilin family which consist of at least three members: alpha-, beta- and gamma-taxilins. Alpha-taxilin was identified as a novel binding partner of the syntaxin family, which is involved in intracellular vesicle traffic. Alpha-taxilin is ubiquitously expressed. It plays an essential role for release of HBV-DNA containing particles. Alpha-taxilin encompasses 546 aa and has a calculated molecular weight of 62 kDa. It migrates on SDS-PAGE with an apparent molecular weight of 75 kDa. (PMID: 12558796; 23816704)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Alpha Taxilin antibody 27558-1-AP | Download protocol |
IHC protocol for Alpha Taxilin antibody 27558-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |