Tested Applications
| Positive WB detected in | LNCaP cells, MCF-7 cells, HeLa cells, HepG2 cells, A549 cells, Jurkat cells, HEK-293 cells, K-562 cells | 
| Positive IHC detected in | human ovary tumor tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 | 
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below | 
Product Information
66475-1-Ig targets Thioredoxin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human | 
| Cited Reactivity | human | 
| Host / Isotype | Mouse / IgG2a | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag6355 Product name: Recombinant human TXN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-105 aa of BC003377 Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV Predict reactive species | 
                                    
| Full Name | thioredoxin | 
| Calculated Molecular Weight | 12 kDa | 
| Observed Molecular Weight | 12 kDa | 
| GenBank Accession Number | BC003377 | 
| Gene Symbol | TXN | 
| Gene ID (NCBI) | 7295 | 
| RRID | AB_2881841 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | P10599 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
TXN, TRDX, TRX, TRX1, ADF and SASP, belongs to the thioredoxin family. It participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. TXN plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. TXN induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Thioredoxin antibody 66475-1-Ig | Download protocol | 
| IHC protocol for Thioredoxin antibody 66475-1-Ig | Download protocol | 
| WB protocol for Thioredoxin antibody 66475-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Redox Biol Guiding bar motif of thioredoxin reductase 1 modulates enzymatic activity and inhibitor binding by communicating with the co-factor FAD and regulating the flexible C-terminal redox motif | ||
Biol Trace Elem Res Pharmacological Inhibition of TXNRD1 by a Small Molecule Flavonoid Butein Overcomes Cisplatin Resistance in Lung Cancer Cells | ||
Mol Cell Deciphering functional tumor-immune crosstalk through highly multiplexed imaging and deep visual proteomics | 













