• Featured Product
  • KD/KO Validated

Thioredoxin Monoclonal antibody

Thioredoxin Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66475-1-Ig
Clone No.1F3C1

Host / Isotype

Mouse / IgG2a

Reactivity

Human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

ADF, ATL derived factor, SASP, thioredoxin, TRDX, TRX, TRX1, TXN

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, MCF-7 cells, HeLa cells, HepG2 cells, A549 cells, Jurkat cells, HEK-293 cells, K-562 cells
Positive IHC detected inhuman ovary tumor tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

66475-1-Ig targets Thioredoxin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6355

Product name: Recombinant human TXN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-105 aa of BC003377

Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Predict reactive species
Full Name thioredoxin
Calculated Molecular Weight 12 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC003377
Gene Symbol TXN
Gene ID (NCBI) 7295
RRIDAB_2881841
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10599
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TXN, TRDX, TRX, TRX1, ADF and SASP, belongs to the thioredoxin family. It participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. TXN plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. TXN induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.

Protocols

Product Specific Protocols
WB protocol for Thioredoxin antibody 66475-1-IgDownload protocol
IHC protocol for Thioredoxin antibody 66475-1-IgDownload protocol
IF protocol for Thioredoxin antibody 66475-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Redox Biol

Guiding bar motif of thioredoxin reductase 1 modulates enzymatic activity and inhibitor binding by communicating with the co-factor FAD and regulating the flexible C-terminal redox motif

Authors - Wuyang Shi
humanWB

Biol Trace Elem Res

Pharmacological Inhibition of TXNRD1 by a Small Molecule Flavonoid Butein Overcomes Cisplatin Resistance in Lung Cancer Cells

Authors - Rui Yang

Mol Cell

Deciphering functional tumor-immune crosstalk through highly multiplexed imaging and deep visual proteomics

Authors - Xiang Zheng
Loading...
||
New chat Able
正在加载,请稍候...