TRX2/TXN2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRX2/TXN2 Polyclonal antibody (13089-1-AP)

• Featured Product
• KD/KO Validated

TRX2/TXN2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13089-1-AP Copied!

Publications (38)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

TRX2, MT TRX, MTRX, Mt-Trx, Thioredoxin 2

• 

  WB analysis of Raji using 13089-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 13089-1-AP (TRX2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13089-1-AP

  WB result of TRX2/TXN2 antibody (13089-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRX2/TXN2 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 13089-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13089-1-AP (TRX2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 13089-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 13089-1-AP (TRX2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRX2/TXN2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Raji cells, HeLa cells, human liver tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13089-1-AP targets TRX2/TXN2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3640

  Product name: Recombinant human TRX2,TXN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC013726

  Sequence: MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG

• Full Name: thioredoxin 2
• Calculated Molecular Weight: 166 aa, 18 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC013726
• Gene Symbol: Thioredoxin 2
• Gene ID (NCBI): 25828
• RRID: AB_2304119
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99757
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TXN2 (Thioredoxin-2) is also named as TRX2, MTRX, Mt-TRX and regulates the mitochondrial redox state and plays an important role in cell proliferation. It has been shown that cells conditionally deficient in Trx2 undergo apoptosis in the absence of exogenous stress, accompanied by an accumulation of intracellular ROS, the activation of caspase 9 and caspase 3, and the release of cytochrome c into the cytosol. In the retina, the expression profile and the role of Trx2 have not yet been defined (PMID: 18441302).

Publications

What published studies show

Anti-TRX2 (Cat# 13089-1-AP) has 38 citations published in journals including Nature Communications, Free Radical Biology and Medicine, Cell Reports, Antioxidants, International Journal of Molecular Sciences, Journal of Alzheimer's Disease, FEBS Journal, Advanced Science, and others. Research fields span oxidative stress and redox biology, mitochondrial function, neurodegeneration (Alzheimer's disease), cardiovascular pathology, diabetic nephropathy, cancer, ophthalmology, immunology, ecotoxicology, and aging. Applications include WB, IF, and IHC across human, mouse, rat, and other species.

Automatically generated from the 38 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; G6PD protects from oxidative damage and improves healthspan in mice.; Authors - Sandrina Nóbrega-Pereira
mouse	WB	Exp Mol Med; Nicotinamide enhances osteoblast differentiation through activation of the mitochondrial antioxidant defense system; Authors - Heein Yoon
human	WB	Adv Sci (Weinh); Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer; Authors - Rong Wang
mouse,human	WB,IHC,IF	J Pharm Anal; Coral calcium hydride promotes peripheral mitochondrial division and reduces AT-II cells damage in ARDS via activation of the Trx2/Myo19/Drp1 pathway; Authors - Qian Li
mouse	WB	Int J Mol Med; Anthocyanins inhibit high glucose-induced renal tubular cell apoptosis caused by oxidative stress in db/db mice.; Authors - Jinying Wei
mouse	WB	Antioxidants (Basel); GCN5L1-Mediated Lysine Acetylation Regulates Mitochondrial Bioenergetics and Redox Homeostasis in the Aged Heart.; Authors - Jackson E. Stewart ; KO Validated