Tested Applications
| Positive WB detected in | Raji cells, human liver tissue | 
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 27 publications below | 
| IHC | See 4 publications below | 
| IF | See 7 publications below | 
Product Information
13089-1-AP targets TRX2/TXN2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag3640 Product name: Recombinant human TRX2,TXN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC013726 Sequence: MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG Predict reactive species | 
                                    
| Full Name | thioredoxin 2 | 
| Calculated Molecular Weight | 166 aa, 18 kDa | 
| Observed Molecular Weight | 12 kDa | 
| GenBank Accession Number | BC013726 | 
| Gene Symbol | Thioredoxin 2 | 
| Gene ID (NCBI) | 25828 | 
| RRID | AB_2304119 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q99757 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
TXN2 (Thioredoxin-2) is also named as TRX2, MTRX, Mt-TRX and regulates the mitochondrial redox state and plays an important role in cell proliferation. It has been shown that cells conditionally deficient in Trx2 undergo apoptosis in the absence of exogenous stress, accompanied by an accumulation of intracellular ROS, the activation of caspase 9 and caspase 3, and the release of cytochrome c into the cytosol. In the retina, the expression profile and the role of Trx2 have not yet been defined (PMID: 18441302).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TRX2/TXN2 antibody 13089-1-AP | Download protocol | 
| WB protocol for TRX2/TXN2 antibody 13089-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Adv Sci (Weinh) Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer | ||
Cell Rep The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense. | ||
Mol Ther Nucleic Acids Diverging targets mediate the pathological roleof miR-199a-5p and miR-199a-3p by promoting cardiac hypertrophy and fibrosis | ||
Int J Mol Sci TRX2/Rab35 Interaction Impairs Exosome Secretion by Inducing Rab35 Degradation.
  | ||
Free Radic Biol Med Oxidative stress as a candidate mechanism for accelerated neuroectodermal differentiation due to trisomy 21. | 





