TXNL6 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 11203-1-AP (same clone as 11203-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11203-1-AP (TXNL6 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11203-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 11203-1-AP (same clone as 11203-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11203-1-AP (TXNL6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11203-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 11203-1-AP (same clone as 11203-1-PBS)

  IP result of anti-TXNL6 (IP:11203-1-AP, 4ug; Detection:11203-1-AP 1:500) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 11203-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11203-1-AP (same clone as 11203-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 11203-1-AP (TXNL6 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 11203-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11203-1-AP (same clone as 11203-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 11203-1-AP (TXNL6 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 11203-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11203-1-AP (same clone as 11203-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 11203-1-AP (TXNL6 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 11203-1-PBS in a different storage buffer formulation.

TXNL6 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11203-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

11203-1-PBS targets TXNL6 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1691

  Product name: Recombinant human TXNL6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-212 aa of BC014127

  Sequence: MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF

• Full Name: nucleoredoxin-like 1
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 26-28 kDa
• GenBank Accession Number: BC014127
• Gene Symbol: NXNL1
• Gene ID (NCBI): 115861
• RRID: AB_2158126
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CM4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TXNL6, also named as NXNL1, belongs to the nucleoredoxin family. It may play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods. TXNL6 is a Novel Oxidative Stress-Induced Reducing System for Methionine Sulfoxide Reductase A Repair of a-Crystallin and Cytochrome C in the Eye Lens. It serve as a reducing system for MsrA repair of the essential lens chaperone a-crystallin/sHSP and mitochondrial cytochrome c. TXNL6 is induced at high levels in human lens epithelial cells exposed to H2O2-induced oxidative stress.(PMID:21079812)