TYK2 Polyclonal antibody

• 

  WB analysis using 16412-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16412-1-AP (TYK2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 16412-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16412-1-AP (TYK2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 16412-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16412-1-AP (TYK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TYK2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16412-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

EC:2.7.10.2, JTK1, tyrosine kinase 2

---

Tested Applications

• Positive WB detected in: Jurkat cells, RAW 264.7 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 1 publications below

Product Information

16412-1-AP targets TYK2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9462

  Product name: Recombinant human TYK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 901-1187 aa of BC014243

  Sequence: RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC

• Full Name: tyrosine kinase 2
• Calculated Molecular Weight: 1187 aa, 134 kDa
• Observed Molecular Weight: 134 kDa
• GenBank Accession Number: BC014243
• Gene Symbol: TYK2
• Gene ID (NCBI): 7297
• RRID: AB_2918047
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29597
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biomed Pharmacother; JAK1/JAK2 degraders based on PROTAC for topical treatment of atopic dermatitis; Authors - Junchao Wu
mouse	WB	J Biol Chem; Elongator is required for pattern recognition receptor and type I interferon signaling in macrophages.; Authors - Jamie Murphy
human	IF	J Cosmet Dermatol; Dual-Targeting Oligopeptide-215 Regulates Skin Barrier Homeostasis Through Concurrent Modulation of JAK-STAT and NF-κB Signaling.; Authors - Qianqian Zhang
mouse	WB	Inflamm Res; IL-22/IL-22R signaling attenuates mitochondrial damage in PCOS by modulating granulosa cell lipid metabolism through ETS1.; Authors - Man Luo
mouse	WB	Dev Cell; Secreted PTEN binds PLXDC2 on macrophages to drive antitumor immunity and tumor suppression; Authors - Cheng Zhang