TYK2 Polyclonal antibody, PBS Only

• 

  WB analysis using 16412-1-AP (same clone as 16412-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16412-1-AP (TYK2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16412-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16412-1-AP (same clone as 16412-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16412-1-AP (TYK2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16412-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16412-1-AP (same clone as 16412-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16412-1-AP (TYK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16412-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 16412-1-AP (same clone as 16412-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using TYK2 antibody (16412-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16412-1-PBS in a different storage buffer formulation.

TYK2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 16412-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16412-1-PBS targets TYK2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9462

  Product name: Recombinant human TYK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 901-1187 aa of BC014243

  Sequence: RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC

• Full Name: tyrosine kinase 2
• Calculated Molecular Weight: 1187 aa, 134 kDa
• Observed Molecular Weight: 134 kDa
• GenBank Accession Number: BC014243
• Gene Symbol: TYK2
• Gene ID (NCBI): 7297
• RRID: AB_2918047
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29597
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.