TYK2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TYK2 Polyclonal antibody (16412-1-AP)

TYK2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16412-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

EC:2.7.10.2, JTK1, tyrosine kinase 2

• 

  WB analysis using 16412-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16412-1-AP (TYK2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16412-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16412-1-AP (TYK2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16412-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16412-1-AP (TYK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TYK2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, RAW 264.7 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16412-1-AP targets TYK2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9462

  Product name: Recombinant human TYK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 901-1187 aa of BC014243

  Sequence: RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC

• Full Name: tyrosine kinase 2
• Calculated Molecular Weight: 1187 aa, 134 kDa
• Observed Molecular Weight: 134 kDa
• GenBank Accession Number: BC014243
• Gene Symbol: TYK2
• Gene ID (NCBI): 7297
• RRID: AB_2918047
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29597
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TYK2 Polyclonal antibody (Cat# 16412-1-AP) has 5 total citations published in Developmental Cell, Biomedicine & Pharmacotherapy, Inflammation Research, Journal of Cosmetic Dermatology, and Veterinary Microbiology. The associated research fields span antitumor immunity, atopic dermatitis pharmacotherapy, polycystic ovary syndrome and lipid metabolism, skin barrier homeostasis, and viral JAK-STAT signaling antagonism.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Dev Cell; Secreted PTEN binds PLXDC2 on macrophages to drive antitumor immunity and tumor suppression; Authors - Cheng Zhang
mouse	WB	Biomed Pharmacother; JAK1/JAK2 degraders based on PROTAC for topical treatment of atopic dermatitis; Authors - Junchao Wu
mouse	WB	Inflamm Res; IL-22/IL-22R signaling attenuates mitochondrial damage in PCOS by modulating granulosa cell lipid metabolism through ETS1.; Authors - Man Luo
human	IF	J Cosmet Dermatol; Dual-Targeting Oligopeptide-215 Regulates Skin Barrier Homeostasis Through Concurrent Modulation of JAK-STAT and NF-κB Signaling.; Authors - Qianqian Zhang
		Vet Microbiol; SADS-CoV N protein antagonizes JAK-STAT signaling pathway by targeting STAT1 for degradation.; Authors - Meiqi Liu