TYROBP/DAP12 Polyclonal antibody

• 

  WB analysis of RAW 264.7 using 28138-1-AP

  WB result of TYROBP/DAP12 antibody (28138-1-AP; 1:600; room temperature for 1.5 hours) with wild-type and sg-TYROBP/DAP12 transfected RAW 264.7 cells.

• 

  WB analysis using 28138-1-AP

  THP-1 cells were subjected to SDS PAGE followed by western blot with 28138-1-AP (TYROBP / DAP12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

TYROBP/DAP12 Polyclonal Antibody for WB, ELISA

Cat No. 28138-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

TYROBP, DAP12, DNAX activation protein 12, DNAX-activation protein 12, KAR associated protein

---

Tested Applications

• Positive WB detected in: THP-1 cells, RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

28138-1-AP targets TYROBP/DAP12 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27252

  Product name: Recombinant human TYROBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of BC011175

  Sequence: MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK

• Full Name: TYRO protein tyrosine kinase binding protein
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 10-12 kDa
• GenBank Accession Number: BC011175
• Gene Symbol: TYROBP
• Gene ID (NCBI): 7305
• RRID: AB_3669646
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43914
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TYROBP, also known as DAP12 or KARAP, is a transmembrane protein consisting of a very small extracellular region, a transmembrane domain containing an aspartic acid residue critical for association with its partner subunits, and an intracellular domain with a single immunoreceptor tyrosine-based activation motif (ITAM) (PMID: 11114420). It is expressed as a disulfide-bonded homodimer on natural killer cells, myeloid cells and a subset of T cells (PMID: 11114420). TYROBP acts as a signaling adaptor that provides signaling function via the Syk and ZAP-70 tyrosine kinase activation pathways (PMID: 15895090). The gene of TYROBP is located on the long arm of chromosome 19 at position 13.1. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Phytomedicine; Berberine modulates microglial polarization by activating TYROBP in Alzheimer's disease; Authors - Yu Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Katia (Verified Customer) (09-09-2025)

The antibody performed well on mouse brain homogenate. However, it did not yield a signal in primary cells homogenate, possibly due to lower protein loading. Notably, a different DAP12 antibody worked under the same conditions.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Mouse brain - mouse primary cells