TIM21 Polyclonal antibody, PBS Only

• 

  IHC staining of human liver using 16641-1-AP (same clone as 16641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16641-1-AP (Tim21 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16641-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16641-1-AP (same clone as 16641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16641-1-AP (Tim21 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16641-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 16641-1-AP (same clone as 16641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16641-1-AP (Tim21 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16641-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 16641-1-AP (same clone as 16641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16641-1-AP (Tim21 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16641-1-PBS in a different storage buffer formulation.

TIM21 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 16641-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

C18orf55, TIMM21, HSPC154, Mitochondrial import inner membrane translocase subunit Tim21, TIM21-like protein, mitochondrial

---

Product Information

16641-1-PBS targets TIM21 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10002

  Product name: Recombinant human C18orf55 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-248 aa of BC000892

  Sequence: MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSKIYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRYIFVEIESYPRRTIIIEDNRSQDD

• Full Name: chromosome 18 open reading frame 55
• Calculated Molecular Weight: 28 kDa
• GenBank Accession Number: BC000892
• Gene Symbol: Tim21
• Gene ID (NCBI): 29090
• RRID: AB_2062082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BVV7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.