Timp-3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human placenta using 83627-1-RR (same clone as 83627-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 83627-1-RR (Timp-3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83627-1-PBS in a different storage buffer formulation.

• 

  FC experiment of MDA-MB-231 using 83627-1-RR (same clone as 83627-1-PBS)

  1x10^6 MDA-MB-231 cells were intracellularly stained with 0.25 ug Timp-3 Recombinant antibody (83627-1-RR, Clone:240374D8) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83627-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83627-1-RR (same clone as 83627-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Timp-3 Recombinant antibody (83627-1-RR, Clone:240374D8) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83627-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83627-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83627-1-RR against Human Timp-3 were performed. The affinity constant is 2.63 nM.

Timp-3 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83627-1-PBS

Clone No.240374D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

TIMP3, 240374D8, HSMRK222, K222, K222TA2

---

Product Information

83627-1-PBS targets Timp-3 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34657

  Product name: Recombinant human Timp-3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 168-211 aa of BC014277

  Sequence: MLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

• Full Name: TIMP metallopeptidase inhibitor 3
• Calculated Molecular Weight: 24 kDa
• GenBank Accession Number: BC014277
• Gene Symbol: TIMP3
• Gene ID (NCBI): 7078
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P35625
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.