HVEM/TNFRSF14 Recombinant monoclonal antibody

• 

  WB analysis using 87402-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87402-1-RR (Tnfrsf14 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87402-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87402-1-RR against Mouse Tnfrsf14 were performed. The affinity constant is 30.8 nM.

HVEM/TNFRSF14 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87402-1-RR

Clone No.252718C4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

CD270, Herpes virus entry mediator A, Herpesvirus entry mediator A, HveA, hvem

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87402-1-RR targets HVEM/TNFRSF14 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3145

  Product name: Recombinant mouse Tnfrsf14 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 39-207 aa of NM_178931.2

  Sequence: QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV

• Full Name: tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: NM_178931.2
• Gene Symbol: Tnfrsf14
• Gene ID (NCBI): 230979
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q80WM9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian tumor necrosis factor receptor (TNFR) family consists of 10 cell-surface proteins that regulate development and homeostasis of the immune system. Member 14 of TNFR (TNFRSF14, also named as TR2, ATAR, HVEA, HVEM, LIGHTR) was also identified as a mediator of herpesvirus entry into mammalian cells. The cytoplasmic region of TNFRSF14 bound to several members of the TNFR-associated factor (TRAF) family, namely TRAF1, TRAF2, TRAF3, and TRAF5.