Mouse Tnfrsf14 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP03187-1

  The mean HVEM/TNFRSF14 concentration was determined to be 24,080.87 ng/mL in mouse spleen tissue extract based on a 6.40 mg/mL extract load, 3,492.44 ng/mL in mouse lung tissue extract based on a 5.00 mg/mL extract load and 13,470.89 ng/mL in mouse liver tissue extract based on a 8.40 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP03187-1

  Sandwich ELISA standard curve of MP03187-1, Mouse HVEM/TNFRSF14 Recombinant Matched Antibody Pair - PBS only. 87402-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg3145. 87402-1-PBS was HRP conjugated as the detection antibody. Range: 4.69-150 ng/mL.

Tnfrsf14 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 87402-2-PBS

Clone No.252718C9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

CD270, Herpes virus entry mediator A, Herpesvirus entry mediator A, HveA, hvem

---

Product Information

87402-2-PBS targets Tnfrsf14 as part of a matched antibody pair:

MP03187-1: 87402-2-PBS capture and 87402-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3145

  Product name: Recombinant mouse Tnfrsf14 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 39-207 aa of NM_178931.2

  Sequence: QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV

• Full Name: tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: NM_178931.2
• Gene Symbol: Tnfrsf14
• Gene ID (NCBI): 230979
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q80WM9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.