Mouse HVEM/TNFRSF14 Recombinant monoclonal antibody, PBS Only (Detector)

HVEM/TNFRSF14 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 87402-1-PBS
Clone No.252718C4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Sandwich ELISA, Indirect ELISA

CD270, Herpes virus entry mediator A, Herpesvirus entry mediator A, HveA, hvem

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87402-1-PBS targets HVEM/TNFRSF14 as part of a matched antibody pair:

MP03187-1: 87402-2-PBS capture and 87402-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3145

Product name: Recombinant mouse Tnfrsf14 protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 39-207 aa of NM_178931.2

Sequence: QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV

Predict reactive species
Full Name tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Calculated Molecular Weight30 kDa
Observed Molecular Weight30-40 kDa
GenBank Accession NumberNM_178931.2
Gene Symbol Tnfrsf14
Gene ID (NCBI) 230979
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ80WM9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The mammalian tumor necrosis factor receptor (TNFR) family consists of 10 cell-surface proteins that regulate development and homeostasis of the immune system. Member 14 of TNFR (TNFRSF14, also named as TR2, ATAR, HVEA, HVEM, LIGHTR) was also identified as a mediator of herpesvirus entry into mammalian cells. The cytoplasmic region of TNFRSF14 bound to several members of the TNFR-associated factor (TRAF) family, namely TRAF1, TRAF2, TRAF3, and TRAF5.

Loading...
||
New chat

Able

正在加载,请稍候...