TULA; UBASH3A Polyclonal antibody

TULA; UBASH3A Polyclonal Antibody for ELISA
Cat No. 13357-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Cbl interacting protein 4, CLIP4, STS 2, STS2, T cell ubiquitin ligand, TULA, UBASH3A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

13357-1-AP targets TULA; UBASH3A in ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4170

Product name: Recombinant human TULA; UBASH3A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-344 aa of BC028138

Sequence: MAAGETQLYAKVSNKLKGRSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPIPQEYALFLCPTGPLLEKLQEFWRESKRQCAKNRAHEVFPHVTLCDFFTCEDQKVECLYEALKRAGDRLLGSFPTAVPLALHSSISYLGFFVSGSPADVIREFAMTFATEASLLADCSVKPCTKQLHLTLAHKFYPHHQRTLEQLARAIPLGHSCQWTAALYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMYTFSLATDLNSRKDGEASSRCSGEFLPQTARS

Predict reactive species
Full Name ubiquitin associated and SH3 domain containing, A
Calculated Molecular Weight 74 kDa, 70 kDa
GenBank Accession NumberBC028138
Gene Symbol UBASH3A
Gene ID (NCBI) 53347
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP57075
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UBASH3A gene encodes ubiquitin-associated and SH3 domain-containing protein A (UBASH3A)/ Suppressor of T-cell receptor signaling 2 (STS2), also known as T-cell ubiquitin ligand 1 (TULA1) which is one of two family members belonging to the T-cell ubiquitin ligand (TULA) family. UBASH3A gene expression is limited to only a few tissues, with its highest expression in spleen, peripheral blood leukocytes, and bone marrow. UBASH3A protein is associated with c-Cbl and ubiquitylated proteins and has been implicated in the regulation of signaling mediated by protein-tyrosine kinases oth family members can negatively regulate T-cell signaling. UBASH3A can facilitate growth factor withdrawal-induced apoptosis in T cells via its interaction with apoptosis-inducing factor (AIF).

Loading...
||
New chat

Able

正在加载,请稍候...