UBE2L6 Polyclonal antibody

• 

  WB analysis of Jurkat using 17278-1-AP

  WB result of UBE2L6 antibody (17278-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-UBE2L6 transfected Jurkat cells.

• 

  WB analysis of Jurkat using 17278-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17278-1-AP (UBE2L6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 17278-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17278-1-AP (UBE2L6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 17278-1-AP

  IP result of anti-UBE2L6 (IP:17278-1-AP, 4ug; Detection:17278-1-AP 1:1000) with Jurkat cells lysate 2000ug.

• 

  IF Staining of HeLa using 17278-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using UBE2L6 antibody (17278-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

UBE2L6 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 17278-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

RIG B, UBCH8, UBE2L6, Ubiquitin carrier protein L6, Ubiquitin protein ligase L6

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IP detected in: Jurkat cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 6 publications below
• IHC: See 1 publications below

Product Information

17278-1-AP targets UBE2L6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11045

  Product name: Recombinant human UBE2L6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-153 aa of BC032491

  Sequence: MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS

• Full Name: ubiquitin-conjugating enzyme E2L 6
• Calculated Molecular Weight: 153 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC032491
• Gene Symbol: UBE2L6
• Gene ID (NCBI): 9246
• RRID: AB_2211001
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14933
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cell Commun Signal; Decursin induces FLT3-ITD acute myeloid leukemia cell apoptosis by increasing the expression of the ubiquitin-conjugase UBE2L6; Authors - Tianxin Zhang
human	WB	Genomics Proteomics Bioinformatics; High VHL Expression Reverses Warburg Phenotype and Enhances Immunogenicity in Kidney Tumor Cells.; Authors - Songbiao Zhu
human	WB	Commun Biol; The germline factor DDX4 contributes to the chemoresistance of small cell lung cancer cells; Authors - Christopher Noyes ; KD Validated
human	IHC	Anticancer Res; Association of UBE2L6 and ABCB6 Expression With Platinum Resistance in Serous Ovarian Carcinoma; Authors - Mami Shibahara
human	WB	Cell Death Dis; Induced TRIM21 ISGylation by IFN-β enhances p62 ubiquitination to prevent its autophagosome targeting.; Authors - Jie Jin
human	WB	Exp Gerontol; p53 accelerates endothelial cell senescence in diabetic retinopathy by enhancing FoxO3a ubiquitylation and degradation via UBE2L6; Authors - Ying Cheng