UBE2L6 Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 17278-1-AP (same clone as 17278-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17278-1-AP (UBE2L6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17278-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 17278-1-AP (same clone as 17278-1-PBS)

  WB result of UBE2L6 antibody (17278-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-UBE2L6 transfected Jurkat cells. This data was developed using the same antibody clone with 17278-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 17278-1-AP (same clone as 17278-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17278-1-AP (UBE2L6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17278-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 17278-1-AP (same clone as 17278-1-PBS)

  IP result of anti-UBE2L6 (IP:17278-1-AP, 4ug; Detection:17278-1-AP 1:1000) with Jurkat cells lysate 2000ug. This data was developed using the same antibody clone with 17278-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 17278-1-AP (same clone as 17278-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using UBE2L6 antibody (17278-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 17278-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

UBE2L6 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 17278-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

17278-1-PBS targets UBE2L6 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11045

  Product name: Recombinant human UBE2L6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-153 aa of BC032491

  Sequence: MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS

• Full Name: ubiquitin-conjugating enzyme E2L 6
• Calculated Molecular Weight: 153 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC032491
• Gene Symbol: UBE2L6
• Gene ID (NCBI): 9246
• RRID: AB_2211001
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14933
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.