Tested Applications
| Positive WB detected in | Caco-2 cells, human brain tissue, U-87 MG cells, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
14100-1-AP targets UBL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5233 Product name: Recombinant human UBL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC059385 Sequence: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL Predict reactive species |
| Full Name | ubiquitin-like 3 |
| Calculated Molecular Weight | 117 aa, 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC059385 |
| Gene Symbol | UBL3 |
| Gene ID (NCBI) | 5412 |
| RRID | AB_2212060 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95164 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ubiquitin-like 3 (UBL3)/membrane-anchored Ub-fold protein (MUB) acts as a post-translational modification (PTM) factor to regulate efficient protein sorting to sEVs (small extracellular vesicles). (PMID: 31363817, PMID: 30258067).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for UBL3 antibody 14100-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biol Open Intracellular dynamics of ubiquitin-like 3 visualized using an inducible fluorescent timer expression system | ||
Mol Brain Comprehensive identification of ubiquitin-like 3 (UBL3)-interacting proteins in the mouse brain |



