Tested Applications
Positive WB detected in | Caco-2 cells, human brain tissue, U-87 MG cells, mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
14100-1-AP targets UBL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5233 Product name: Recombinant human UBL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC059385 Sequence: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL Predict reactive species |
Full Name | ubiquitin-like 3 |
Calculated Molecular Weight | 117 aa, 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC059385 |
Gene Symbol | UBL3 |
Gene ID (NCBI) | 5412 |
RRID | AB_2212060 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95164 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ubiquitin-like 3 (UBL3)/membrane-anchored Ub-fold protein (MUB) acts as a post-translational modification (PTM) factor to regulate efficient protein sorting to sEVs (small extracellular vesicles). (PMID: 31363817, PMID: 30258067).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for UBL3 antibody 14100-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Biol Open Intracellular dynamics of ubiquitin-like 3 visualized using an inducible fluorescent timer expression system | ||
Mol Brain Comprehensive identification of ubiquitin-like 3 (UBL3)-interacting proteins in the mouse brain |