UBL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UBL3 Polyclonal antibody (14100-1-AP)

UBL3 Polyclonal Antibody for WB, ELISA

Cat No. 14100-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

HCG 1, HsMUB, MUB, PNSC1, Protein HCG 1, ubiquitin like 3, Ubiquitin like protein 3, UBL3

• 

  WB analysis using 14100-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14100-1-AP (UBL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 14100-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14100-1-AP (UBL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UBL3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Caco-2 cells, human brain tissue, U-87 MG cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14100-1-AP targets UBL3 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5233

  Product name: Recombinant human UBL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-117 aa of BC059385

  Sequence: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL

• Full Name: ubiquitin-like 3
• Calculated Molecular Weight: 117 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC059385
• Gene Symbol: UBL3
• Gene ID (NCBI): 5412
• RRID: AB_2212060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95164
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitin-like 3 (UBL3)/membrane-anchored Ub-fold protein (MUB) acts as a post-translational modification (PTM) factor to regulate efficient protein sorting to sEVs (small extracellular vesicles). (PMID: 31363817, PMID: 30258067).

Publications

What published studies show

The anti-UBL3 antibody (Cat# 14100-1-AP) has 3 total citations published in Scientific Reports, Molecular Brain, and Biology Open. Research fields include ubiquitin-like 3 modification's role in PD-L1 sorting to extracellular vesicles, UBL3-interacting protein identification in the mouse brain, and intracellular dynamics of UBL3 visualized via a fluorescent timer system. Applications cited are Western blot and immunoprecipitation in human and mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Sci Rep; Statins attenuate PD-L1 sorting to small extracellular vesicles dependent on ubiquitin-like 3 modification.; Authors - Hiroshi Ageta ; KD Validated
mouse	WB	Mol Brain; Comprehensive identification of ubiquitin-like 3 (UBL3)-interacting proteins in the mouse brain; Authors - Hiroshi Ageta
human	WB	Biol Open; Intracellular dynamics of ubiquitin-like 3 visualized using an inducible fluorescent timer expression system; Authors - Yuka Terada