Tested Applications
| Positive WB detected in | BGC-823 cells, BxPC-3 cells, HeLa cells, MKN-45 cells |
| Positive IHC detected in | human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29413-1-AP targets UBQLN4 in WB, IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29658 Product name: Recombinant human UBQLN4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 82-186 aa of BC063841 Sequence: IKTPQKAQDPAAATASSPSTPDPASAPSTTPASPATPAQPSTSGSASSDAGSGSRRSSGGGPSPGAGEGSPSATASILSGFGGILGLGSLGLGSANFMELQQQMQ Predict reactive species |
| Full Name | ubiquilin 4 |
| Calculated Molecular Weight | 601 aa, 64 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC063841 |
| Gene Symbol | UBQLN4 |
| Gene ID (NCBI) | 56893 |
| RRID | AB_3086129 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRR5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ubiquilins (UBQLNs) are important factors for cell proteostasis maintenance. UBQLNs are involved in the modulation of the cell cycle, as well as in apoptosis, membrane receptors regulation, DNA repair, epithelial-mesenchymal transition, and miRNA activities. Ubiquilin 4 (UBQLN4) is an important member of the ubiquitin-like protein family. UBQLN4 is overexpressed in aggressive tumors and inhibits homologous recombination, redirecting doublestrand break repair to nonhomologous end joining, resulting in increased genome instability and inducing carcinogenesis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UBQLN4 antibody 29413-1-AP | Download protocol |
| WB protocol for UBQLN4 antibody 29413-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







