Product Information
29413-1-PBS targets UBQLN4 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29658 Product name: Recombinant human UBQLN4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 82-186 aa of BC063841 Sequence: IKTPQKAQDPAAATASSPSTPDPASAPSTTPASPATPAQPSTSGSASSDAGSGSRRSSGGGPSPGAGEGSPSATASILSGFGGILGLGSLGLGSANFMELQQQMQ Predict reactive species |
| Full Name | ubiquilin 4 |
| Calculated Molecular Weight | 601 aa, 64 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC063841 |
| Gene Symbol | UBQLN4 |
| Gene ID (NCBI) | 56893 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRR5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Ubiquilins (UBQLNs) are important factors for cell proteostasis maintenance. UBQLNs are involved in the modulation of the cell cycle, as well as in apoptosis, membrane receptors regulation, DNA repair, epithelial-mesenchymal transition, and miRNA activities. Ubiquilin 4 (UBQLN4) is an important member of the ubiquitin-like protein family. UBQLN4 is overexpressed in aggressive tumors and inhibits homologous recombination, redirecting doublestrand break repair to nonhomologous end joining, resulting in increased genome instability and inducing carcinogenesis.







