UBQLN4 Polyclonal antibody, PBS Only

• 

  WB analysis using 29413-1-AP (same clone as 29413-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29413-1-AP (UBQLN4 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29413-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 29413-1-AP (same clone as 29413-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 29413-1-AP (UBQLN4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29413-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 29413-1-AP (same clone as 29413-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 29413-1-AP (UBQLN4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29413-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 29413-1-AP (same clone as 29413-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 29413-1-AP (UBQLN4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29413-1-PBS in a different storage buffer formulation.

UBQLN4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29413-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

29413-1-PBS targets UBQLN4 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29658

  Product name: Recombinant human UBQLN4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-186 aa of BC063841

  Sequence: IKTPQKAQDPAAATASSPSTPDPASAPSTTPASPATPAQPSTSGSASSDAGSGSRRSSGGGPSPGAGEGSPSATASILSGFGGILGLGSLGLGSANFMELQQQMQ

• Full Name: ubiquilin 4
• Calculated Molecular Weight: 601 aa, 64 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC063841
• Gene Symbol: UBQLN4
• Gene ID (NCBI): 56893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRR5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ubiquilins (UBQLNs) are important factors for cell proteostasis maintenance. UBQLNs are involved in the modulation of the cell cycle, as well as in apoptosis, membrane receptors regulation, DNA repair, epithelial-mesenchymal transition, and miRNA activities. Ubiquilin 4 (UBQLN4) is an important member of the ubiquitin-like protein family. UBQLN4 is overexpressed in aggressive tumors and inhibits homologous recombination, redirecting doublestrand break repair to nonhomologous end joining, resulting in increased genome instability and inducing carcinogenesis.