UCHL5IP Polyclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 17830-1-AP (same clone as 17830-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 17830-1-AP (UCHL5IP Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17830-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 17830-1-AP (same clone as 17830-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 17830-1-AP (UCHL5IP Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17830-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 17830-1-AP (same clone as 17830-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 17830-1-AP (UCHL5IP Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17830-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 17830-1-AP (same clone as 17830-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 17830-1-AP (UCHL5IP antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17830-1-PBS in a different storage buffer formulation.

UCHL5IP Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17830-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

17830-1-PBS targets UCHL5IP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12225

  Product name: Recombinant human UCHL5IP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 38-368 aa of BC008141

  Sequence: AVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWGGSSSVMSLATKMNELMEK

• Full Name: UCHL5 interacting protein
• Calculated Molecular Weight: 368 aa, 41 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC008141
• Gene Symbol: UCHL5IP
• Gene ID (NCBI): 55559
• RRID: AB_2878447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99871
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.