Tested Applications
| Positive WB detected in | HepG2 cells, Raji cells, K-562 cells | 
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28762-1-AP targets UCKL1 in WB, IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag30535 Product name: Recombinant human UCKL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 39-196 aa of BC033078 Sequence: SNAESLDRLLPPVGTGRSPRKRTTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKT Predict reactive species | 
                                    
| Full Name | uridine-cytidine kinase 1-like 1 | 
| Calculated Molecular Weight | 419 aa, 46 kDa | 
| Observed Molecular Weight | 61 kDa | 
| GenBank Accession Number | BC033078 | 
| Gene Symbol | UCKL1 | 
| Gene ID (NCBI) | 54963 | 
| RRID | AB_3086084 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9NWZ5 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Uridine cytidine kinase like-1 (UCKL-1) is a largely uncharacterized protein over-expressed in many tumor cells, especially in highly malignant, aggressive tumors. Sequence analysis indicates that UCKL-1 has homology to uridine kinases, enzymes that play a role in DNA and RNA synthesis and that are often up-regulated in tumor cells. Previous studies have shown that UCKL-1 is a substrate for natural killer lytic-associated molecule (NKLAM), an E3 ubiquitin ligase found in NK cell cytolytic granules. Ubiquitination of UCKL-1 by NKLAM leads to its degradation. Increased expression of NKLAM enhances NK-mediated tumoricidal activity. (PMID: 32083188)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UCKL1 antibody 28762-1-AP | Download protocol | 
| WB protocol for UCKL1 antibody 28762-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 





