Tested Applications
| Positive WB detected in | mouse brown adipose tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | mouse brown adipose tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23673-1-AP targets UCP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, rabbit, bovine, hamster, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20388 Product name: Recombinant human UCP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-307 aa of BC098168 Sequence: MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT Predict reactive species |
| Full Name | uncoupling protein 1 (mitochondrial, proton carrier) |
| Calculated Molecular Weight | 307 aa, 33 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC098168 |
| Gene Symbol | UCP1 |
| Gene ID (NCBI) | 7350 |
| RRID | AB_2828003 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25874 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UCP-1 (Mitochondrial uncoupling protein 1), is a mitochondrial transporter protein that creates proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. It has been identified a key molecule for metabolic thermogenesis to avoid an excess of fat accumulation. UCP-1 expression is usually restricted to brown adipose when induced by cold exposure and thyroid hormone.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UCP1 antibody 23673-1-AP | Download protocol |
| WB protocol for UCP1 antibody 23673-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-UCP1 antibody (Cat# 23673-1-AP) has accumulated 183 citations. Publications appear in journals including Nature, Nature Metabolism, Nature Communications, Signal Transduction and Targeted Therapy, Advanced Science, Cell Reports, Science Advances, Diabetes, Journal of Biological Chemistry, International Journal of Molecular Sciences, and Frontiers in Physiology, among 90+ others. Research fields center on adipose tissue browning and thermogenesis, obesity and metabolic disorders, lipid metabolism, gut microbiota, diabetes, and mitochondrial biology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther GRP75 triggers white adipose tissue browning to promote cancer-associated cachexia
| ||
Nature Feeding induces cholesterol biosynthesis via the mTORC1-USP20-HMGCR axis.
| ||
Nat Metab Gpnmb secreted from liver promotes lipogenesis in white adipose tissue and aggravates obesity and insulin resistance. | ||
Nat Commun Avian GCGR-mediated continuous fat utilization offers perspectives for obesity treatment. | ||
Nat Commun Adipocyte YTH N(6)-methyladenosine RNA-binding protein 1 protects against obesity by promoting white adipose tissue beiging in male mice | ||
Nat Commun Brown adipose tissue secretes OLFM4 to coordinate sensory and sympathetic innervation via Schwann cells |
Reviews
What customers say
The antibody performed well in Western Blot on human brown adipocytes at a 1:1000 dilution. The band at the expected molecular weight was very clear and distinct. However, the reviewer noted the presence of several non-specific bands alongside the target signal. Overall, the product received a 4 out of 5 rating, indicating good performance with minor non-specific binding.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mi (Verified Customer) (03-06-2023) | It works well in human brown adipocyte cells. Although we got several non-specific bands, the band at the expected size was very clear.
|
