UCP1 Polyclonal antibody

• 

  WB analysis using 32710-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32710-1-AP (Ucp1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brown adipose using 32710-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 32710-1-AP (Ucp1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brown adipose using 32710-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 32710-1-AP (Ucp1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

UCP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32710-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

Mitochondrial brown fat uncoupling protein 1, Slc25a7, Solute carrier family 25 member 7, Thermogenin, Ucp

---

Tested Applications

• Positive WB detected in: mouse brown adipose tissue
• Positive IHC detected in: mouse brown adipose tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32710-1-AP targets UCP1 in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38217

  Product name: Recombinant mouse Ucp1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 97-178 aa of BC012701

  Sequence: DSVQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTT

• Full Name: uncoupling protein 1 (mitochondrial, proton carrier)
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC012701
• Gene Symbol: Ucp1
• Gene ID (NCBI): 22227
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P12242
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UCP-1 (Mitochondrial uncoupling protein 1), is a mitochondrial transporter protein that creates proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. It has been identified a key molecule for metabolic thermogenesis to avoid an excess of fat accumulation. UCP-1 expression is usually restricted to brown adipose when induced by cold exposure and thyroid hormone.