Tested Applications
| Positive WB detected in | mouse brown adipose tissue |
| Positive IHC detected in | mouse brown adipose tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32710-1-AP targets UCP1 in WB, IHC, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag38217 Product name: Recombinant mouse Ucp1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 97-178 aa of BC012701 Sequence: DSVQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTT Predict reactive species |
| Full Name | uncoupling protein 1 (mitochondrial, proton carrier) |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC012701 |
| Gene Symbol | Ucp1 |
| Gene ID (NCBI) | 22227 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P12242 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UCP-1 (Mitochondrial uncoupling protein 1), is a mitochondrial transporter protein that creates proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. It has been identified a key molecule for metabolic thermogenesis to avoid an excess of fat accumulation. UCP-1 expression is usually restricted to brown adipose when induced by cold exposure and thyroid hormone.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UCP1 antibody 32710-1-AP | Download protocol |
| WB protocol for UCP1 antibody 32710-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





