UCP1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• UCP1 Recombinant monoclonal antibody, PBS Only (83870-1-PBS)

UCP1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 83870-1-PBS Copied!

Clone No. 240782F3

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

240782F3, SLC25A7, Thermogenin, UCP, UCP 1

• 

  WB analysis of mouse brown adipose using 83870-1-RR (same clone as 83870-1-PBS)

  mouse brown adipose tissue were subjected to SDS PAGE followed by western blot with 83870-1-RR (UCP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83870-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 83870-1-RR (same clone as 83870-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 83870-1-RR (UCP1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83870-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 83870-1-RR (same clone as 83870-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 83870-1-RR (UCP1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83870-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brown adipose using 83870-1-RR (same clone as 83870-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brown adipose tissue using UCP1 antibody (83870-1-RR, Clone: 240782F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83870-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brown adipose using 83870-1-RR (same clone as 83870-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brown adipose tissue using UCP1 antibody (83870-1-RR, Clone: 240782F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83870-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 83870-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83870-1-RR against Human UCP1 were performed. The affinity constant is 64.6 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UCP1 in ?

Chat with Able

---

Product Information

83870-1-PBS targets UCP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20388

  Product name: Recombinant human UCP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-307 aa of BC098168

  Sequence: MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT

• Full Name: uncoupling protein 1 (mitochondrial, proton carrier)
• Calculated Molecular Weight: 307 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC098168
• Gene Symbol: UCP1
• Gene ID (NCBI): 7350
• RRID: AB_3671456
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P25874
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UCP-1 (Mitochondrial uncoupling protein 1), is a mitochondrial transporter protein that creates proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. It has been identified a key molecule for metabolic thermogenesis to avoid an excess of fat accumulation. UCP-1 expression is usually restricted to brown adipose when induced by cold exposure and thyroid hormone.